DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and anxa1b

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_861424.1 Gene:anxa1b / 353358 ZFINID:ZDB-GENE-030131-6554 Length:342 Species:Danio rerio


Alignment Length:326 Identity:127/326 - (38%)
Similarity:180/326 - (55%) Gaps:14/326 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PVPTVKDAAP---------FDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAE 60
            |.| .:||.|         |:|..||.||:.|::..|.||..||:||..|||.|||.|||.|:..
Zfish    20 PAP-FQDAGPSGGVKFSQAFNAQNDAAVLKKAIETKGVDEAAIIEVLAKRSNAQRQQIKAAYQQS 83

  Fly    61 FERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQI 125
            ..:.|.|.||..|....|||::.|:|.|.||...::..||.|:||.||.|.|||.|:||.|:..:
Zfish    84 TGKPLADALKKALSSHLEDVVLALLMTPSEYDAFEMRKAMKGLGTNEAVLSEILGTRTNNEIKAM 148

  Fly   126 VAVYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVR-DGLDTPVDVGQAKEQAAQLYSAGEAKLG 189
            ...:.|.|...|.|.:.||.||.....|..:....| :|.:  :|...|...|..||.|||.::|
Zfish   149 KNSFREAYGELLEENIKSEVSGQLETTLLALCQATRPEGYN--IDDALAHTDAKALYEAGEHRIG 211

  Fly   190 TDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFAN 254
            |...|...:::..|..||...|:.|..||.:...:|::.|:...|.:.::.||:...:..|:||.
Zfish   212 TVVSVLIDVLTTRSDAQLVKTFQYYGQLSKKGFAKALESELHGHLEDCLLTIVKSAWNKPAYFAE 276

  Fly   255 RLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLG 319
            :|:.||.|.|||:.||||||||||||||..|.||:..:..::|.:| :..||.|||::.|..:.|
Zfish   277 KLHLAMKGLGTDNDTLIRIIVSRSEIDLTKIMQEYSTMQGQSLQAA-IQKETKGDYQKILLTICG 340

  Fly   320 S 320
            :
Zfish   341 A 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 30/64 (47%)
Annexin 91..156 CDD:278615 25/64 (39%)
Annexin 176..241 CDD:278615 19/64 (30%)
Annexin 251..317 CDD:278615 34/65 (52%)
anxa1bNP_861424.1 Annexin 43..107 CDD:278615 30/63 (48%)
Annexin 114..179 CDD:278615 25/64 (39%)
Annexin 198..263 CDD:278615 19/64 (30%)
Annexin 273..338 CDD:278615 34/65 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8875
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10502
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.