DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and ANXA11

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_005269798.1 Gene:ANXA11 / 311 HGNCID:535 Length:605 Species:Homo sapiens


Alignment Length:312 Identity:146/312 - (46%)
Similarity:210/312 - (67%) Gaps:2/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDE 72
            |:.||..||..:||:|||.||||||||||.|||.|..|||:|||.|...::..:.:||:.|||.|
Human   293 TITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSE 357

  Fly    73 LGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPL 137
            |.|.||..|:.||..||.:...::..|:.|:||:||.|:|||.:::||.:.::...|:..:::.|
Human   358 LSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTL 422

  Fly   138 AEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHA 202
            .|.:.|:|||.|:|||..:..|.||. .|.||:..|:..|.:||:|||.:|||||..||.::...
Human   423 EEAIRSDTSGHFQRLLISLSQGNRDE-STNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSR 486

  Fly   203 SFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTDD 267
            |...|..||.||:.::|:.||::|..|||.:|.|.|:|:|:|:::..||||.||.|||.||||.|
Human   487 SRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKD 551

  Fly   268 ATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLG 319
            .|||||:|||||.||..|:.|::|:|.::|:.. :..:|||||::.|..:.|
Human   552 RTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHD-ISGDTSGDYRKILLKICG 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 37/64 (58%)
Annexin 91..156 CDD:278615 23/64 (36%)
Annexin 176..241 CDD:278615 29/64 (45%)
Annexin 251..317 CDD:278615 36/65 (55%)
ANXA11XP_005269798.1 Annexin 304..369 CDD:278615 37/64 (58%)
Annexin 376..441 CDD:278615 23/64 (36%)
Annexin 459..525 CDD:278615 29/65 (45%)
Annexin 535..600 CDD:278615 36/65 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.