DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and ANXA4

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001144.1 Gene:ANXA4 / 307 HGNCID:542 Length:321 Species:Homo sapiens


Alignment Length:312 Identity:145/312 - (46%)
Similarity:206/312 - (66%) Gaps:2/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDE 72
            |||.|:.|:|.:|||.||.||||.||||..||.||..|:..|||.|:..|::...|||:||||.|
Human     9 TVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSE 73

  Fly    73 LGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPL 137
            |.|.||.||||:|.|.|.|..::|..||.|.||:|..|:|||.::|.||:.:|...|:::|.|.|
Human    74 LSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSL 138

  Fly   138 AEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHA 202
            .:.:.|:||..|:|:|..:..|.||. ...:|....::.|..||.|||.|.||||..|..::...
Human   139 EDDIRSDTSFMFQRVLVSLSAGGRDE-GNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSR 202

  Fly   203 SFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTDD 267
            :...|..||:|||.:|.:.|||:||.|.|....:|::|||:|:::.:|:||.:|||:|.|.||||
Human   203 NRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDD 267

  Fly   268 ATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLG 319
            .||||::|||:|||:..|:..|:|:|.::|:| .:..:|||||::.|..|.|
Human   268 NTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYS-FIKGDTSGDYRKVLLVLCG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 38/64 (59%)
Annexin 91..156 CDD:278615 26/64 (41%)
Annexin 176..241 CDD:278615 27/64 (42%)
Annexin 251..317 CDD:278615 33/65 (51%)
ANXA4NP_001144.1 Annexin 21..85 CDD:395139 38/63 (60%)
Annexin 92..157 CDD:395139 26/64 (41%)
Annexin 175..241 CDD:395139 27/65 (42%)
Annexin 251..316 CDD:395139 33/65 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10502
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.