DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9578 and AT4G34270

DIOPT Version :9

Sequence 1:NP_608377.1 Gene:CG9578 / 33018 FlyBaseID:FBgn0031094 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_195153.2 Gene:AT4G34270 / 829577 AraportID:AT4G34270 Length:290 Species:Arabidopsis thaliana


Alignment Length:297 Identity:92/297 - (30%)
Similarity:143/297 - (48%) Gaps:68/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPVDSEFIQFHDWAIKYEKSHILKSSCQLGTAKCCPKDSADRCDLCHYQHSLQLPHLPDMVFHKN 75
            ||.....::.|||.|:..:..||.|..                 :..::..|:..|||:|||.:|
plant    18 LPDGRRGLRIHDWEIETLRGTILTSLA-----------------VEEWEKKLKTSHLPEMVFGEN 65

  Fly    76 RLVLQHKDGAT-LEFCPMDALA-LVDNGKQPLEVACAQEW--RETRNEQTMEEKFKPFDWTFTST 136
            .|||:|....| :.|...|||| ....|..|:||..|.:|  |...::|.:.:    :|:|||:.
plant    66 ALVLKHLGSNTKIHFNAFDALAGWKQEGLPPVEVPAAAQWKFRSKPSQQVILD----YDYTFTTP 126

  Fly   137 YQG---------TMNEKV--RSETTNQ------TLNKFKLMQRENIIFYHDLTLFEDELHDHGIS 184
            |.|         |:..|.  :.|.|.|      .::...|..:|.|:||.::.|:||||.|:|:|
plant   127 YCGSEVVEKDKETVEAKANPKGEATLQWENCEDQIDLAALSLKEPILFYDEVVLYEDELADNGVS 191

  Fly   185 VMSVRIRVMPSGFFILLRHFLRVDHVLIRMHDTRFHHEIENDFILKEYIHREAPCTELQNC---- 245
            :::|::|||||.:|:|||.:||||.||:|:.:||.|:....|         |||....:||    
plant   192 LLTVKVRVMPSSWFLLLRFWLRVDGVLMRLRETRMHYRFGED---------EAPTVLRENCWREA 247

  Fly   246 -------------VAFWTNPDEMQEFVPVKSKQLHKL 269
                         :|.|::|..:.:.:||......||
plant   248 TFQSLSAKGYPVDLAVWSDPSSISQRLPVIKHTTQKL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9578NP_608377.1 TIP41 79..236 CDD:282083 61/177 (34%)
AT4G34270NP_195153.2 TIP41 62..246 CDD:398031 70/196 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2220
eggNOG 1 0.900 - - E1_KOG3224
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7140
Inparanoid 1 1.050 125 1.000 Inparanoid score I1942
OMA 1 1.010 - - QHG54984
OrthoDB 1 1.010 - - D1377237at2759
OrthoFinder 1 1.000 - - FOG0004871
OrthoInspector 1 1.000 - - oto2867
orthoMCL 1 0.900 - - OOG6_103322
Panther 1 1.100 - - LDO PTHR21021
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3435
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.