DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9578 and tiprl

DIOPT Version :9

Sequence 1:NP_608377.1 Gene:CG9578 / 33018 FlyBaseID:FBgn0031094 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001015736.1 Gene:tiprl / 548453 XenbaseID:XB-GENE-5917981 Length:273 Species:Xenopus tropicalis


Alignment Length:263 Identity:107/263 - (40%)
Similarity:162/263 - (61%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DSEFIQFHDWAIKYEKSHILKSSCQLGTAKCCPKDSADRCDLCHYQHSLQLPHLPDMVFHKNRLV 78
            :.|| :|..|.:...|:||:||:                 |.......:.:|.||:|:|..|.|.
 Frog    10 NQEF-KFGPWQLTAIKTHIMKSA-----------------DAEKLAEEMSMPCLPEMMFGDNVLR 56

  Fly    79 LQHKDGATLEFCPMDALALVDNGKQPLEVACAQEWRETRNE-QTMEEKFKPFDWTFTSTYQGTM- 141
            :||..|..:||...|||.:|.:.:..|:||||:||:|:|:: :..:|..||:|||:|:.|:||: 
 Frog    57 IQHTSGFGIEFNAKDALKVVKSNQASLKVACAEEWQESRSDSEHNKEVVKPYDWTYTTDYKGTLL 121

  Fly   142 --NEKVRSETTNQTLNKFKLMQRENIIFYHDLTLFEDELHDHGISVMSVRIRVMPSGFFILLRHF 204
              |.|:....|...:|..||..||.|:|:.::.||||||||||:|.:||:|||||:.||:|||:|
 Frog   122 GDNMKLNVIPTTDKINTEKLKAREQIMFFEEVLLFEDELHDHGVSSLSVKIRVMPTSFFLLLRYF 186

  Fly   205 LRVDHVLIRMHDTRFHHEIENDFILKEYIHREAPCTELQNC-VAFWTNPDEMQEFVPVKSKQLHK 268
            ||||.|||||:|||.:||.:..|:|:||..:|:..:.|.:. ...:|.|:|:.:::||......|
 Frog   187 LRVDGVLIRMNDTRLYHEADKTFMLREYTSKESKISNLSHVPPPLYTEPNEISQYLPVTQTIYEK 251

  Fly   269 LFF 271
            |.|
 Frog   252 LEF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9578NP_608377.1 TIP41 79..236 CDD:282083 80/160 (50%)
tiprlNP_001015736.1 TIP41 50..218 CDD:367852 83/167 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 174 1.000 Domainoid score I3630
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7140
Inparanoid 1 1.050 197 1.000 Inparanoid score I3693
OMA 1 1.010 - - QHG54984
OrthoDB 1 1.010 - - D1377237at2759
OrthoFinder 1 1.000 - - FOG0004871
OrthoInspector 1 1.000 - - oto103968
Panther 1 1.100 - - LDO PTHR21021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1526
SonicParanoid 1 1.000 - - X3435
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.