DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9578 and ZK688.11

DIOPT Version :9

Sequence 1:NP_608377.1 Gene:CG9578 / 33018 FlyBaseID:FBgn0031094 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001040896.1 Gene:ZK688.11 / 4363059 WormBaseID:WBGene00044762 Length:168 Species:Caenorhabditis elegans


Alignment Length:97 Identity:24/97 - (24%)
Similarity:38/97 - (39%) Gaps:32/97 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TRN-EQTMEEKFKPFDWTFTSTYQGTMNEKVRSETTNQTLNKFKLMQRENI---IFYHDLTL--- 173
            :|| |.||:...|..:      ..|..||::.|..:       |:||:.|.   :.:...||   
 Worm    34 SRNQEMTMKNVEKKVE------QMGAKNEEMFSMIS-------KIMQKPNSTGHLQWDSQTLADL 85

  Fly   174 ------FEDELHDHGI------SVMSVRIRVM 193
                  |:|:.....:      |.||||.|.:
 Worm    86 MNKSDSFDDDQESLNMPRSSESSAMSVRNRTL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9578NP_608377.1 TIP41 79..236 CDD:282083 24/97 (25%)
ZK688.11NP_001040896.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3224
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.