powered by:
Protein Alignment CG9578 and ZK688.11
DIOPT Version :9
Sequence 1: | NP_608377.1 |
Gene: | CG9578 / 33018 |
FlyBaseID: | FBgn0031094 |
Length: | 272 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001040896.1 |
Gene: | ZK688.11 / 4363059 |
WormBaseID: | WBGene00044762 |
Length: | 168 |
Species: | Caenorhabditis elegans |
Alignment Length: | 97 |
Identity: | 24/97 - (24%) |
Similarity: | 38/97 - (39%) |
Gaps: | 32/97 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 TRN-EQTMEEKFKPFDWTFTSTYQGTMNEKVRSETTNQTLNKFKLMQRENI---IFYHDLTL--- 173
:|| |.||:...|..: ..|..||::.|..: |:||:.|. :.:...||
Worm 34 SRNQEMTMKNVEKKVE------QMGAKNEEMFSMIS-------KIMQKPNSTGHLQWDSQTLADL 85
Fly 174 ------FEDELHDHGI------SVMSVRIRVM 193
|:|:.....: |.||||.|.:
Worm 86 MNKSDSFDDDQESLNMPRSSESSAMSVRNRTL 117
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9578 | NP_608377.1 |
TIP41 |
79..236 |
CDD:282083 |
24/97 (25%) |
ZK688.11 | NP_001040896.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3224 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.