DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9578 and Tiprl

DIOPT Version :9

Sequence 1:NP_608377.1 Gene:CG9578 / 33018 FlyBaseID:FBgn0031094 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001103137.1 Gene:Tiprl / 360869 RGDID:1310442 Length:271 Species:Rattus norvegicus


Alignment Length:257 Identity:106/257 - (41%)
Similarity:158/257 - (61%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FHDWAIKYEKSHILKSSCQLGTAKCCPKDSADRCDLCHYQHSLQLPHLPDMVFHKNRLVLQHKDG 84
            |..|.:...|:||:||:                 |:......|.:|.||:|:|..|.|.:||..|
  Rat    15 FGPWKLTASKTHIMKSA-----------------DVEKLADELHMPSLPEMMFGDNVLRIQHGSG 62

  Fly    85 ATLEFCPMDALALVDNGKQPLEVACAQEWRETRNE-QTMEEKFKPFDWTFTSTYQGTM---NEKV 145
            ..:||...|||..|:|.:..|:||||:||:|:|.| :..:|..||:|||:|:.|:||:   :.|:
  Rat    63 FGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKL 127

  Fly   146 RSETTNQTLNKFKLMQRENIIFYHDLTLFEDELHDHGISVMSVRIRVMPSGFFILLRHFLRVDHV 210
            :...|...::..||..||.|.|:.::.||||||||||:|.:||:||||||.||:|||.|||:|.|
  Rat   128 KVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGV 192

  Fly   211 LIRMHDTRFHHEIENDFILKEYIHREAPCTELQNC-VAFWTNPDEMQEFVPVKSKQLHKLFF 271
            ||||:|||.:||.:..::|:||..||:....|.:. .:.:|.|:|:.:::|:|.....||.|
  Rat   193 LIRMNDTRLYHEADKTYMLREYTSRESKIANLMHVPPSLFTEPNEISQYLPIKEAVCEKLVF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9578NP_608377.1 TIP41 79..236 CDD:282083 79/160 (49%)
TiprlNP_001103137.1 TIP41 50..218 CDD:398031 82/167 (49%)
Interaction with PPP2CA. /evidence=ECO:0000250 173..271 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340773
Domainoid 1 1.000 170 1.000 Domainoid score I3680
eggNOG 1 0.900 - - E1_KOG3224
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7140
Inparanoid 1 1.050 199 1.000 Inparanoid score I3720
OMA 1 1.010 - - QHG54984
OrthoDB 1 1.010 - - D1377237at2759
OrthoFinder 1 1.000 - - FOG0004871
OrthoInspector 1 1.000 - - oto97289
orthoMCL 1 0.900 - - OOG6_103322
Panther 1 1.100 - - LDO PTHR21021
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3435
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.