DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9578 and TIPRL

DIOPT Version :9

Sequence 1:NP_608377.1 Gene:CG9578 / 33018 FlyBaseID:FBgn0031094 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_690866.1 Gene:TIPRL / 261726 HGNCID:30231 Length:272 Species:Homo sapiens


Alignment Length:257 Identity:106/257 - (41%)
Similarity:159/257 - (61%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FHDWAIKYEKSHILKSSCQLGTAKCCPKDSADRCDLCHYQHSLQLPHLPDMVFHKNRLVLQHKDG 84
            |..|.:...|:||:||:                 |:......|.:|.||:|:|..|.|.:||..|
Human    15 FGPWKLTASKTHIMKSA-----------------DVEKLADELHMPSLPEMMFGDNVLRIQHGSG 62

  Fly    85 ATLEFCPMDALALVDNGKQPLEVACAQEWRETRNE-QTMEEKFKPFDWTFTSTYQGTM---NEKV 145
            ..:||...|||..|:|.:..|:||||:||:|:|.| :..:|..||:|||:|:.|:||:   :.|:
Human    63 FGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKL 127

  Fly   146 RSETTNQTLNKFKLMQRENIIFYHDLTLFEDELHDHGISVMSVRIRVMPSGFFILLRHFLRVDHV 210
            :...|...::..||..||.|.|:.::.||||||||||:|.:||:||||||.||:|||.|||:|.|
Human   128 KVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGV 192

  Fly   211 LIRMHDTRFHHEIENDFILKEYIHREAPCTELQNC-VAFWTNPDEMQEFVPVKSKQLHKLFF 271
            ||||:|||.:||.:..::|:||..||:..:.|.:. .:.:|.|:|:.:::|:|.....||.|
Human   193 LIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9578NP_608377.1 TIP41 79..236 CDD:282083 79/160 (49%)
TIPRLNP_690866.1 TIP41 50..218 CDD:309341 82/167 (49%)
Interaction with PPP2CA 173..272 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147109
Domainoid 1 1.000 170 1.000 Domainoid score I3791
eggNOG 1 0.900 - - E1_KOG3224
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7140
Inparanoid 1 1.050 200 1.000 Inparanoid score I3791
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54984
OrthoDB 1 1.010 - - D1377237at2759
OrthoFinder 1 1.000 - - FOG0004871
OrthoInspector 1 1.000 - - oto90171
orthoMCL 1 0.900 - - OOG6_103322
Panther 1 1.100 - - LDO PTHR21021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1526
SonicParanoid 1 1.000 - - X3435
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.