DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taok3 and Pak

DIOPT Version :9

Sequence 1:NP_001074777.1 Gene:Taok3 / 330177 MGIID:3041177 Length:898 Species:Mus musculus
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:307 Identity:120/307 - (39%)
Similarity:172/307 - (56%) Gaps:18/307 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 RKGALKDPEIAD----LFFKDDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAVKKMSYSGKQT 62
            :|..:.|.||.:    :....||...:..:.:||.|:.|.||.|..:.|...||:|:|:.|.:..
  Fly   540 KKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPK 604

Mouse    63 HEKWQDILKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCL-GSASDLLEVHKKPLQEVEIAA 126
            .|.   |:.|:..:::.||||.:.|...||.....|:||||.. ||.:|:  |.:..:.|.:|||
  Fly   605 KEL---IINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDV--VTETCMDEGQIAA 664

Mouse   127 ITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANS----FVGTPYWMAP 187
            :....||.|.:||.:.:||||||:.||||...|.|||.|||..:..||..|    .|||||||||
  Fly   665 VCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAP 729

Mouse   188 EVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPTLQSRE-WTDSFR 251
            ||:   ...||..|||:|||||..||:.|.:||..|.|.:.|||.||.|..|.::.:: .:.:|:
  Fly   730 EVV---TRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQ 791

Mouse   252 RFVDYCLHKIPQERPAAVELLRHDFIRRERPPKVLIDLIQRTKDAVR 298
            .|:|.||......|.:|::||:|.|::..||...|..||...|:|.:
  Fly   792 DFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKEATK 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taok3NP_001074777.1 PKc_like 2..314 CDD:389743 120/307 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..424
PTZ00121 <415..881 CDD:173412
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..596
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 109/267 (41%)
S_TKc 566..817 CDD:214567 106/258 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.