DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9581 and FASTKD1

DIOPT Version :9

Sequence 1:NP_608376.1 Gene:CG9581 / 33017 FlyBaseID:FBgn0031093 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001308975.1 Gene:FASTKD1 / 79675 HGNCID:26150 Length:847 Species:Homo sapiens


Alignment Length:311 Identity:60/311 - (19%)
Similarity:101/311 - (32%) Gaps:119/311 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LFGVTEAHPLSQLEAVLA-KRAGALKPHIWFDQKS-----------------TDLPSLAENMLRL 247
            :||..|.:     :|:|: |:.|.....:|..||.                 ..|.:||.|..:|
Human    52 MFGFIERN-----KAILSEKQVGCAFDMLWKLQKQKTSLLKNAEYVRDHPQFLTLHNLATNKFKL 111

  Fly   248 ----------------SGNQQRPLLPAYTFLEAMRLLKSRDEMQLMRRTCDIASRSFNEVMAETR 296
                            :|....||:.|.. .||.|.|: |.:::|:        ..|:..:|   
Human   112 MNDDTLVNVLYVTQQFAGEAHDPLVEALV-TEAWRRLE-RFDIKLL--------SEFSSCLA--- 163

  Fly   297 PGQSEHHLFAAIDYKCRMRNASYLAYPPVVAAGKNATVIHYVANSQLLGQQDL----VLMDAGCE 357
                :.||:                :.|::  ||.|.::|    ..|...|||    |||     
Human   164 ----DQHLY----------------FSPLM--GKIADIVH----RNLETTQDLSSLSVLM----- 197

  Fly   358 YGGYTSDITRTWPASGVFTEPQRTLYDMLHQLQEEIIGNVMK----------PGGETLDQLFETT 412
             ...:|.|:|.:...  .......|:|.:...:..:..::.|          |..|..:.:|.:.
Human   198 -VNISSLISRHFQQQ--LVNKTELLFDTIDSSEVNVAKSIAKFLRNVRYRYQPLLERCNNVFLSN 259

  Fly   413 CYKLGKYLQEIGLVGKSFSEYKELVSQGYRF--------------CPHHVS 449
            ...|     ::..:.|..|.||.|....:.|              |.|..|
Human   260 VDHL-----DLDSISKILSVYKFLQFNSFEFIIMAKKKLTEMIPLCNHPAS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9581NP_608376.1 AMP_N 94..232 CDD:282980 8/31 (26%)
Prolidase 274..517 CDD:238520 36/204 (18%)
FASTKD1NP_001308975.1 FAST_1 575..642 CDD:284217
FAST_2 662..742 CDD:285557
RAP 779..838 CDD:214932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.