DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9581 and XPNPEP1

DIOPT Version :9

Sequence 1:NP_608376.1 Gene:CG9581 / 33017 FlyBaseID:FBgn0031093 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001311062.1 Gene:XPNPEP1 / 7511 HGNCID:12822 Length:695 Species:Homo sapiens


Alignment Length:512 Identity:116/512 - (22%)
Similarity:194/512 - (37%) Gaps:162/512 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VAQILRQQKGNLGQPTSVSHPHLIQPDELVPGVELTEIKERRSQLMQNIRAYARSFGGEFNGHS- 119
            :|::||          |..| |||...|.:.....|:..||..:.:..:       |.::.|.| 
Human   175 MAKVLR----------SAGH-HLIPVKENLVDKIWTDRPERPCKPLLTL-------GLDYTGISW 221

  Fly   120 -SSCHMLVLGAASKKYM------SGKIPYVFR-QNSD-------FYYLTGCLEPDAVLLLTID-- 167
             .....|.|..|.:..|      ..:|.::|. :.||       |.|....||   .::|.||  
Human   222 KDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLE---TIMLFIDGD 283

  Fly   168 --EAQNVQSELFMRPKDPHAELWDGPRTGPELAVPLFGVTEAHP----LSQLEAVLAKRAGALKP 226
              :|.:|:..|.:                 :|.:......:.||    ||:|:|:.|.    |.|
Human   284 RIDAPSVKEHLLL-----------------DLGLEAEYRIQVHPYKSILSELKALCAD----LSP 327

  Fly   227 H--IWFDQKSTDLPSLAENMLRLSGNQQRPLLPAYTFLEAMRLLKSRDEMQLMRRT--------C 281
            .  :|...|::  .:::|.:.:    ..|..:| ||.:...:.:|:..|.:.|||.        |
Human   328 REKVWVSDKAS--YAVSETIPK----DHRCCMP-YTPICIAKAVKNSAESEGMRRAHIKDAVALC 385

  Fly   282 DIASRSFNEVMAET-RPGQSEHHLFAAID--YKCRMRNASY--LAYPPVVAAGKNATVIHYV--- 338
            ::    ||.:..|. :.|.:|   .:|.|  .:.|.:.|.:  |::|.:.:.|.|..:|||.   
Human   386 EL----FNWLEKEVPKGGVTE---ISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVP 443

  Fly   339 ANSQLLGQQDLVLMDAGCEYGGYTSDITRTWPASGVFTEPQRTLYDMLHQLQEEIIGNVMK---- 399
            ..::.|...::.|:|:|.:|...|:|:|||..    |..|  |.|      ::|....|:|    
Human   444 ETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMH----FGTP--TAY------EKECFTYVLKGHIA 496

  Fly   400 ---------PGGETLDQLFETTCYKLG-KYLQEIGLVGKSFSEYKELVSQGYRFCPHHVSHYLGM 454
                     ..|..||....:..:..| .||...|                     |.|..:|  
Human   497 VSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTG---------------------HGVGSFL-- 538

  Fly   455 DVHDTP-----HVPRNTRIVPGMVFTVEPGIYIGQDCGDVPPEFRGIGIRIEDDLLI 506
            :||:.|     ....:..:..||:.|.|||.|          |....|||||:.:|:
Human   539 NVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY----------EDGAFGIRIENVVLV 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9581NP_608376.1 AMP_N 94..232 CDD:282980 34/163 (21%)
Prolidase 274..517 CDD:238520 64/268 (24%)
XPNPEP1NP_001311062.1 Creatinase_N 53..197 CDD:304957 9/32 (28%)
Creatinase_N_2 207..369 CDD:292807 39/199 (20%)
PepP 239..609 CDD:223085 97/430 (23%)
APP 372..594 CDD:238518 64/266 (24%)
Peptidase_M24_C 600..>627 CDD:292806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.