DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9581 and PEPD

DIOPT Version :9

Sequence 1:NP_608376.1 Gene:CG9581 / 33017 FlyBaseID:FBgn0031093 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_000276.2 Gene:PEPD / 5184 HGNCID:8840 Length:493 Species:Homo sapiens


Alignment Length:444 Identity:125/444 - (28%)
Similarity:209/444 - (47%) Gaps:88/444 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VFRQNSDFYYLTGCLEPDAVLLLTIDEAQNVQSELFMRPKDP--HAELWDGPRTGPELAVPLFGV 204
            :|||.|.|::..|..||....::.:|..   :|.||: |:.|  || .|.|.....|.....:.|
Human    64 LFRQESFFHWAFGVTEPGCYGVIDVDTG---KSTLFV-PRLPASHA-TWMGKIHSKEHFKEKYAV 123

  Fly   205 TEAHPLSQLEAVLAKRAGALKPHIWFDQK--STDLPSLA-----ENMLRLSGNQQRPLLPAYTFL 262
            .:...:.::.:||..:    ||.:....:  :||..|:.     :.:.:...|.        |.|
Human   124 DDVQYVDEIASVLTSQ----KPSVLLTLRGVNTDSGSVCREASFDGISKFEVNN--------TIL 176

  Fly   263 E----AMRLLKSRDEMQLMRRTCDIASRSFNEVMAETRPGQSEHHLFAAIDYKC----RMRNASY 319
            .    ..|:.|:..|::::|.|..|:|.:..|||...:.|..|:.|.:..::.|    .||::||
Human   177 HPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSY 241

  Fly   320 LAYPPVVAAGKNATVIHY----VANSQLLGQQDLVLMDAGCEYGGYTSDITRTWPASGVFTEPQR 380
            ..   :..:|:|:.|:||    ..|.:.:...|:.|.|.|.||..:.||||.::||:|.||..|:
Human   242 TC---ICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQK 303

  Fly   381 TLYDMLHQLQEEIIGNVMKPGGETLDQLFETTCYKLGK--YLQEIGLVGKSFSEYKELVSQ--GY 441
            .:|:.:.:....::| .||||      ::....::|..  :|:|:..:|........:|..  |.
Human   304 AVYEAVLRSSRAVMG-AMKPG------VWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGA 361

  Fly   442 RFCPHHVSHYLGMDVHDTPHVP--------------RNTR-IVPGMVFTVEPGIY-----IGQDC 486
            .|.||.:.|:||:||||....|              |..| :.||||.|||||||     :.:..
Human   362 VFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEAL 426

  Fly   487 GD----------VPPEFRGI-GIRIEDDLLINENGHVEVLTEACVKDPRALQEL 529
            .|          |...|||. |:|||:|:::.::| :|:||  ||  ||.::|:
Human   427 ADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSG-IELLT--CV--PRTVEEI 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9581NP_608376.1 AMP_N 94..232 CDD:282980 24/91 (26%)
Prolidase 274..517 CDD:238520 86/285 (30%)
PEPDNP_000276.2 AMP_N 18..155 CDD:198079 26/99 (26%)
Prolidase 192..467 CDD:238520 87/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D200485at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R584
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.