DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9581 and Xpnpep1

DIOPT Version :9

Sequence 1:NP_608376.1 Gene:CG9581 / 33017 FlyBaseID:FBgn0031093 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_038940279.1 Gene:Xpnpep1 / 170751 RGDID:621274 Length:666 Species:Rattus norvegicus


Alignment Length:334 Identity:80/334 - (23%)
Similarity:128/334 - (38%) Gaps:100/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LSQLEAVLAKRAGALKPH--IWFDQKSTDLPSLAENMLRLSGNQQRPLLPAYTFLEAMRLLKSRD 272
            ||:|:.:.|.    |.|.  :|...|::...|.|      .....|..:| ||.:...:.:|:..
  Rat   315 LSELKTLCAD----LSPREKVWVSDKASYAVSEA------IPKDHRCCMP-YTPICIAKAVKNSA 368

  Fly   273 EMQLMRRT--------CDIASRSFNEVMAET-RPGQSEHHLFAAID--YKCRMRNASY--LAYPP 324
            |...|||.        |::    ||.:..|. :.|.:|   .:|.|  .:.|.:.|.:  |::|.
  Rat   369 ESAGMRRAHIKDAVALCEL----FNWLEQEVPKGGVTE---ISAADKAEEFRRQQADFVDLSFPT 426

  Fly   325 VVAAGKNATVIHYV---ANSQLLGQQDLVLMDAGCEYGGYTSDITRTWPASGVFTEPQRTLYDML 386
            :.:.|.|..:|||.   ..::.|...::.|:|:|.:|...|:|:|||..    |..|  |.|   
  Rat   427 ISSTGPNGAIIHYAPIPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMH----FGTP--TAY--- 482

  Fly   387 HQLQEEIIGNVMK-------------PGGETLDQLFETTCYKLG-KYLQEIGLVGKSFSEYKELV 437
               ::|....|:|             ..|..||....:..:..| .||...|             
  Rat   483 ---EKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTG------------- 531

  Fly   438 SQGYRFCPHHVSHYLGMDVHDTP-----HVPRNTRIVPGMVFTVEPGIYIGQDCGDVPPEFRGIG 497
                    |.|..:|  :||:.|     ....:..:..||:.|.|||.|          |....|
  Rat   532 --------HGVGSFL--NVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY----------EDGAFG 576

  Fly   498 IRIEDDLLI 506
            ||||:.:|:
  Rat   577 IRIENVVLV 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9581NP_608376.1 AMP_N 94..232 CDD:282980 7/23 (30%)
Prolidase 274..517 CDD:238520 64/268 (24%)
Xpnpep1XP_038940279.1 Creatinase_N 53..197 CDD:396058
Creatinase_N_2 200..369 CDD:406573 15/64 (23%)
APP 372..594 CDD:238518 64/266 (24%)
Peptidase_M24_C 600..662 CDD:406572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.