DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9581 and Xpnpep1

DIOPT Version :9

Sequence 1:NP_608376.1 Gene:CG9581 / 33017 FlyBaseID:FBgn0031093 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_573479.3 Gene:Xpnpep1 / 170750 MGIID:2180003 Length:666 Species:Mus musculus


Alignment Length:334 Identity:81/334 - (24%)
Similarity:129/334 - (38%) Gaps:100/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LSQLEAVLAKRAGALKPH--IWFDQKSTDLPSLAENMLRLSGNQQRPLLPAYTFLEAMRLLKSRD 272
            ||:|:|:.|.    |.|.  :|...|::...|.|      .....|..:| ||.:...:.:|:..
Mouse   315 LSELKALCAD----LSPREKVWVSDKASYAVSEA------IPKDHRCCMP-YTPICIAKAVKNSA 368

  Fly   273 EMQLMRRT--------CDIASRSFNEVMAET-RPGQSEHHLFAAID--YKCRMRNASY--LAYPP 324
            |...|||.        |::    ||.:..|. :.|.:|   .:|.|  .:.|.:.|.:  |::|.
Mouse   369 ESDGMRRAHIKDAVALCEL----FNWLEQEVPKGGVTE---ISAADKAEEFRRQQADFVDLSFPT 426

  Fly   325 VVAAGKNATVIHYV---ANSQLLGQQDLVLMDAGCEYGGYTSDITRTWPASGVFTEPQRTLYDML 386
            :.:.|.|..:|||.   ..::.|...::.|:|:|.:|...|:|:|||..    |..|  |.|   
Mouse   427 ISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMH----FGTP--TAY--- 482

  Fly   387 HQLQEEIIGNVMK-------------PGGETLDQLFETTCYKLG-KYLQEIGLVGKSFSEYKELV 437
               ::|....|:|             ..|..||....:..:..| .||...|             
Mouse   483 ---EKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTG------------- 531

  Fly   438 SQGYRFCPHHVSHYLGMDVHDTP-----HVPRNTRIVPGMVFTVEPGIYIGQDCGDVPPEFRGIG 497
                    |.|..:|  :||:.|     ....:..:..||:.|.|||.|          |....|
Mouse   532 --------HGVGSFL--NVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY----------EDGAFG 576

  Fly   498 IRIEDDLLI 506
            ||||:.:|:
Mouse   577 IRIENVVLV 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9581NP_608376.1 AMP_N 94..232 CDD:282980 8/23 (35%)
Prolidase 274..517 CDD:238520 64/268 (24%)
Xpnpep1NP_573479.3 Creatinase_N 53..197 CDD:390097
Creatinase_N_2 200..369 CDD:379790 16/64 (25%)
APP 372..594 CDD:238518 64/266 (24%)
Peptidase_M24_C 600..661 CDD:379789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.