DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9577 and CG5044

DIOPT Version :9

Sequence 1:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster


Alignment Length:362 Identity:81/362 - (22%)
Similarity:125/362 - (34%) Gaps:106/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KPTAIGSLKMQRNLSALPESGPTGSFKTLAVSSPKPFVFHVELHRPSKFNAISKQM----WLEIK 75
            |||.:.....|.:.|.|...           ||.|..:.   |:||...|||:.:|    :..:|
  Fly    32 KPTTMALSVRQSSSSVLATE-----------SSNKGMII---LNRPKALNAINLEMVRKIYKHLK 82

  Fly    76 ECFDGLATNPDCRAIVLSASG-KHFTAGIDLNDMINVGQTLAETDDYARKGVSMERMIKVYQDSI 139
            :|      ......:::..:| |.|.||.|:..::..|.| .|:..:.|:..|...:|..|:   
  Fly    83 KC------EKSKSLVIIKGTGDKAFCAGGDVRALVEAGPT-DESKSFFREEYSTNALIGNYK--- 137

  Fly   140 SSLEHCPKPVITAVHKACIGAGVDLITAADIRYCTEDAFFQVKEVDIGMAADVGTLQRLPKAVGS 204
                   .|.|..:....:|.||.|......|..::...|.:.|..||:..|||....||:..| 
  Fly   138 -------IPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQG- 194

  Fly   205 QSLARELCFTGRKFEAAEAHSSGLV-----SRLFPDKDSLLTG---------------------- 242
             .|...|..||.:...|:.:.||:.     |...||.::.|..                      
  Fly   195 -KLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPF 258

  Fly   243 --------------------------------ALAVAELIASKSPVAVKTTKESLVYSLEHTNQE 275
                                            |....|.::..||.::|.|    ...||..:|.
  Fly   259 SLQPVLEQINKNFSADSVEGILENLQNDGSEWAKKTLETLSKMSPTSMKVT----FRQLELGSQL 319

  Fly   276 GLDHILLLN-KL---NLLSEDFAQAVAAQL-TKDDKP 307
            .|...|::. :|   :|...||.:.|.|.| .||.||
  Fly   320 SLAQCLIMEYRLAVRHLERSDFKEGVRALLIDKDQKP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 72/325 (22%)
PRK05617 54..309 CDD:235533 72/323 (22%)
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 77/350 (22%)
ECH_2 56..374 CDD:292731 72/327 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.