DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9577 and Echs1

DIOPT Version :9

Sequence 1:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster


Alignment Length:229 Identity:71/229 - (31%)
Similarity:107/229 - (46%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VELHRPSKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGKHFTAGIDLNDMINVGQTLAE-- 117
            :.|:||...||:...:..|:.......:.:....||||:.|.|.|.||.|:.:|  ||.|.::  
  Fly    55 ITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGADIKEM--VGNTYSQCI 117

  Fly   118 ----TDDYARKGVSMERMIKVYQDSISSLEHCPKPVITAVHKACIGAGVDLITAADIRYCTEDAF 178
                .:|:                  :.:....||:|.||:...:|.|.:|....||.|..:.|.
  Fly   118 QGNFLNDW------------------TEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAK 164

  Fly   179 FQVKEVDIGMAADVGTLQRLPKAVGSQSLARELCFTGRKFEAAEAHSSGLVSRLFPDKDSLLTGA 243
            |...|:.:|.....|..|||.:.|| :|.|.|:|.||....|.||...||.|::.| .|.||..|
  Fly   165 FGQPEIALGTIPGAGGTQRLTRVVG-KSKAMEMCLTGNMIGAQEAEKLGLASKVVP-ADQLLGEA 227

  Fly   244 LAVAELIASKSPVAVKTTKESLVYSLEHTNQEGL 277
            :.:.|.|.:.|.:.|:..||::..:.|.|.||||
  Fly   228 VKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 71/229 (31%)
PRK05617 54..309 CDD:235533 71/229 (31%)
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.