DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9577 and CG4592

DIOPT Version :9

Sequence 1:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001260306.1 Gene:CG4592 / 34317 FlyBaseID:FBgn0032162 Length:287 Species:Drosophila melanogaster


Alignment Length:252 Identity:57/252 - (22%)
Similarity:104/252 - (41%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KPTAIGSLKMQRNLSALPESGPTGSFKTLAVSSPKPFVFHVELHRPSKFNAISKQMWLEIKECFD 79
            ||...|...: |:|:    :|.|....|:.|.. :..:..:.::.| ..|.::.::..::.:..:
  Fly    14 KPILCGGQSL-RSLA----NGATSKLTTIEVDD-RSGIATLSMNLP-PVNTLTMELMHDLIDSIN 71

  Fly    80 GLATNPDCRAIVLSASGKHFTAGIDLNDMINVGQTLAETDDYARKGVSMERMIKVYQDSISSLEH 144
            .:.:|.....|:.|::.|.|:||:|||:|:|        .|..|..:...|    :||...:|..
  Fly    72 QIESNKSRGLILTSSNDKVFSAGLDLNEMLN--------PDVERLRLFWTR----FQDLWLALHL 124

  Fly   145 CPKPVITAVHKACIGAGVDLITAADIRYCTEDAFFQVKEVDIGMAADVGTLQR----LPKAVGSQ 205
            |..|...|::.....||..|.||.:.|....:.|..:.............:..    ||:.:..:
  Fly   125 CGLPTAAAINGHSPAAGCVLATACEYRVMLPNLFIGIHATRFSFVISKWMMNSYQSVLPRRIVER 189

  Fly   206 SLARELCFTGRKFEAAEAHSSGLVSRLFPDKDSLLTGALAVAELIASKSPVAVKTTK 262
            :|.:     |:.|.:.||...|||..:...|:..|:...|........:|||...||
  Fly   190 ALNQ-----GKLFASQEALDVGLVDEIACSKEEALSKCAAFIATFDKTNPVARCLTK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 48/215 (22%)
PRK05617 54..309 CDD:235533 48/213 (23%)
CG4592NP_001260306.1 crotonase-like 43..284 CDD:304874 48/217 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.