DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9577 and CG4594

DIOPT Version :9

Sequence 1:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001260305.1 Gene:CG4594 / 34316 FlyBaseID:FBgn0032161 Length:280 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:95/233 - (40%) Gaps:28/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TGSFKTLAVSSPKPFVFHVELHRPSKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGKHFTA 101
            |.:..|....:.|..:..:.::|| ..|:.:.|:.|:::.....:..|.....|:.|||...|:|
  Fly    21 TATKLTTVEINDKTGIATLTMNRP-PVNSQNVQLLLDLQTSISEIENNKSRGLILTSASSNVFSA 84

  Fly   102 GIDLNDMINVGQTLAETDDYARKGVSMERMIKVY---QDSISSLEHCPKPVITAVHKACIGAGVD 163
            |:|:.:|.|       ||        :||:..|:   |:...:|.....|...|::......|..
  Fly    85 GLDIFEMYN-------TD--------VERLRTVWTELQNVWIALYGTTLPTAAAINGHAPAGGCL 134

  Fly   164 LITAADIRYCTEDAFFQVKEVDIGMAAD----VGTLQRLPKAVGSQSLARELCFTGRKFEAAEAH 224
            |.||.:.|....:....:.|..:|:.|.    .|....|||.|..::|.:     ||.|...||.
  Fly   135 LATACEYRVMRPNFLIGLNEAQLGIIAPKWLMSGFASILPKRVAERALTQ-----GRMFTTQEAF 194

  Fly   225 SSGLVSRLFPDKDSLLTGALAVAELIASKSPVAVKTTK 262
            ..||:..:...|:..|....|.....|..:|:|...||
  Fly   195 EVGLIDEIASSKEEALEKCAAFIGTFAKVNPLARGLTK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 54/218 (25%)
PRK05617 54..309 CDD:235533 54/216 (25%)
CG4594NP_001260305.1 crotonase-like 35..275 CDD:304874 54/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.