DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9577 and CG4598

DIOPT Version :9

Sequence 1:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster


Alignment Length:277 Identity:59/277 - (21%)
Similarity:112/277 - (40%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MQRN--LSALPESG-----PTGSFKTLAVSSPKPFVFHVELHRPSKFNAISKQMWLEIKECFDGL 81
            |.|:  ||.:..:|     .|.:..|....:.|..:..:.::|| ..|.::.::..::|...|.:
  Fly     1 MMRSKVLSLVARAGSNRMMSTATKLTTVEVNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEI 64

  Fly    82 ATNPDCRAIVLSASGKHFTAGIDLNDMINVGQTLAETDDYARKGVSMERMIKVY----QDSISSL 142
            .:|.....|:.|:|...|:||:|:.:|..        .|..|        |:.:    ||:..:|
  Fly    65 ESNKSRGLILTSSSSTIFSAGLDILEMYK--------PDKDR--------IRAFWTQLQDTWLAL 113

  Fly   143 EHCPKPVITAVHKACIGAGVDLITAADIRYCTEDAFFQVKEVDIGMAAD----VGTLQRLPKAVG 203
            .....|...|::......|..|.|:.:.|....:....:.|..:|:.|.    ...|..||:.:.
  Fly   114 YGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIA 178

  Fly   204 SQSLARELCFTGRKFEAAEAHSSGLVSRLFPDKDSLLTGALAVAELIASKSPVAVKTTKESL--- 265
            .::|.:     ||.|...||...||:.....:|:..:...:|.....|..:|:|...||:..   
  Fly   179 ERALNQ-----GRMFTTEEALKVGLIDETANNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAA 238

  Fly   266 -VYSLEHTNQEGLDHIL 281
             :..|::..:|.|:..|
  Fly   239 DLQQLQNGRKEDLEKFL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 51/242 (21%)
PRK05617 54..309 CDD:235533 51/240 (21%)
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 43/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.