DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9577 and CG14787

DIOPT Version :9

Sequence 1:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster


Alignment Length:257 Identity:53/257 - (20%)
Similarity:96/257 - (37%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FKTLAVSSPKPFVFHVELHRPSKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGKHFTA--G 102
            |:.|.|.. :..:.|:...|     ...::...|:....|..:.:...:.:|||.   .|:|  |
  Fly    10 FRELVVEQ-RSGLLHIRFQR-----RWQRRTLYELMRALDLASADAAVKVVVLSG---EFSAACG 65

  Fly   103 IDLNDMI------NVGQTLAETDDYARKGVSMERMIK------VYQDSISSLEHCPKPVITAVHK 155
            .::..:.      |..:..|..::....|.:.|:.|.      |.:.....|....|.::..|.:
  Fly    66 GEMEPLALKQGLENRSRRTASHEEAVGSGDAEEQYIHEKAANFVMRSLAKKLLVHRKLLVAFVER 130

  Fly   156 ACIGAGVDLITAADIRYCTEDAFFQVKEVDIGMAADVGTLQRLPKA-----VGSQ---------- 205
            .|:|.|:.:.:..|:.:.||.:.|......:.....||....:|..     :|.|          
  Fly   131 QCVGLGLSVCSLCDLVFATELSAFVPAFSHLDPCTKVGPGWTVPHVHWLLRLGDQASSSIALQCG 195

  Fly   206 ---SLARE-LCFTGRKFEAAEAHSSGLVSR---LF-PDKDSLLTGALAVAELIASKSPVAVK 259
               |:.|| ..|..|..:.....|:.|::.   || |.:||||      |||....:|:|.:
  Fly   196 LVASVVREPQEFWHRVDQYLRLPSASLLATKRLLFRPWQDSLL------AELREEGTPLAAQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 50/245 (20%)
PRK05617 54..309 CDD:235533 50/243 (21%)
CG14787NP_569914.2 crotonase-like 13..216 CDD:304874 38/211 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.