DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and PHF6

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001015877.1 Gene:PHF6 / 84295 HGNCID:18145 Length:365 Species:Homo sapiens


Alignment Length:413 Identity:79/413 - (19%)
Similarity:111/413 - (26%) Gaps:182/413 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFGTVHVEGNMMV--HRNCLYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCRL 67
            |..|.|....|.  |.:.:..|..|  |..|:..||.|:.......|:..|..||::.|:.|...
Human    17 CGFCKSNRDKEC--GQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTK 79

  Fly    68 LKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQ----------------------NQFCDTYN 110
            |.|..|...||.|.|....|.||:|..|.:.:.||                      |...|...
Human    80 LMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEE 144

  Fly   111 SFCHQHVLVP----------RNRPVFKN----------------DE------------------- 130
            || ::|.|.|          :.||...|                ||                   
Human   145 SF-NEHELEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRSPHRSSPSDT 208

  Fly   131 --ECLLC---AEDVVAKGERFSVVTCLYAPCCRNGWFHRRCL-------QRYANSSGYF------ 177
              :|..|   .|:..|:|:       |:....:....|.:|:       |....|...|      
Human   209 RPKCGFCHVGEEENEARGK-------LHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIK 266

  Fly   178 -----------FKCPLCNNTDVFRRVAYMGIAVLDQDASWETEPDAFAGQYRRDVNCTAALCVAV 231
                       .||.||                        ::|.|..|       |....||  
Human   267 TVLQEIKRGKRMKCTLC------------------------SQPGATIG-------CEIKACV-- 298

  Fly   232 SGRADTSAMLLYCTSCGANPSHYLCTLKTLQNYV-----------CKVCSAVSPEAVPVAESDSD 285
                              ...||.|.::....|:           ||            ..|.:|
Human   299 ------------------KTYHYHCGVQDKAKYIENMSRGIYKLYCK------------NHSGND 333

  Fly   286 DAGSMDDSAEAPRPGHLNGDQIQ 308
            :....|:..|:...|.:..||.|
Human   334 ERDEEDEERESKSRGKVEIDQQQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 36/134 (27%)
PHF6NP_001015877.1 Nuclear localization signal. /evidence=ECO:0000255 13..16
Extended PHD1 domain (ePHD1). /evidence=ECO:0000255|PROSITE-ProRule:PRU01146 14..132 32/116 (28%)
ePHD1_PHF6 17..131 CDD:277180 32/115 (28%)
Nuclear localization signal. /evidence=ECO:0000255 129..133 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..211 11/72 (15%)
Nucleolar localization signal. /evidence=ECO:0000255 157..169 2/11 (18%)
Extended PHD2 domain (ePHD2). /evidence=ECO:0000255|PROSITE-ProRule:PRU01146 209..330 27/190 (14%)
ePHD2_PHF6 212..329 CDD:277181 27/186 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..365 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141431
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.