DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and phf6

DIOPT Version :10

Sequence 1:NP_608374.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001107695.1 Gene:phf6 / 779543 XenbaseID:XB-GENE-999439 Length:363 Species:Xenopus tropicalis


Alignment Length:132 Identity:40/132 - (30%)
Similarity:55/132 - (41%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFGTVHVEGNMMV--HRNCLYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCRL 67
            |..|.|....|.  |.:.:..|..|  |..|:..||.|:.......::..|..|||:.|:.|.|.
 Frog    17 CGFCRSNREKEC--GQLLISSNQKVAAHHRCMLFSSALVSSQSDSENLGGFSIEDIQKELKRGRK 79

  Fly    68 LKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLA---QNQFCDTYNSFCHQHVLVPRNRPVFKND 129
            |.|..|...||.|.|....|.||:|..|.:.:.|   :|.....|..||.:|     ...|..:|
 Frog    80 LMCSLCHCPGATIGCDVKSCHRTYHYHCALRDKAHIQENPSQGMYTIFCRKH-----KEQVQNSD 139

  Fly   130 EE 131
            :|
 Frog   140 DE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_608374.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 36/115 (31%)
RING_Ubox 129..183 CDD:473075 2/3 (67%)
phf6NP_001107695.1 ePHD1_PHF6 17..131 CDD:277180 36/115 (31%)
ePHD2_PHF6 210..327 CDD:277181
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.