DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and Phf11c

DIOPT Version :10

Sequence 1:NP_608374.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001157761.1 Gene:Phf11c / 628705 MGIID:3648476 Length:339 Species:Mus musculus


Alignment Length:72 Identity:21/72 - (29%)
Similarity:27/72 - (37%) Gaps:14/72 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 RKDILERYVALHPAMREPKILGEW-------SGLRPARKTIRIEKVEKKSEKSGKKYTVV----- 301
            ||..||.::.:|.. .:|.|..|.       |.|....||...|| .....:.||.:|..     
Mouse   198 RKQELEIHMRIHTG-EKPYICSECGKSFTCKSSLNNHIKTHTGEK-PFACAQCGKSFTTKASLKN 260

  Fly   302 HHYGHGG 308
            |..||.|
Mouse   261 HTNGHTG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_608374.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139
RING_Ubox 129..183 CDD:473075
Phf11cNP_001157761.1 PHD_SF 48..161 CDD:473978
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.