DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and g2e3

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001003822.1 Gene:g2e3 / 368848 ZFINID:ZDB-GENE-030616-400 Length:706 Species:Danio rerio


Alignment Length:382 Identity:109/382 - (28%)
Similarity:174/382 - (45%) Gaps:55/382 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICVLCLSGERDELIFG-TVHVE-GNMMVHRNCLYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCR 66
            ||.||...|.::..:| .||:| .|:.||..||.:||.:.||||:...:..||..||:.|:.|..
Zfish    19 ICCLCKRSENNKEKYGEKVHLEQHNLAVHFFCLLMSSGICQRGEEDEDVYGFLVGDIKKEIRRSS 83

  Fly    67 LLKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQNQFCDTYNSFCHQHVLVPRNRPVFKNDEE 131
            .|:|.:|::.||::.|....||:..|..||::.....||...:.|||.:|...............
Zfish    84 RLRCFHCKKAGASVGCSIKSCRQMVHMPCGLEQEFVFQFTGLFPSFCKKHAPTQSCDSSHSLPHS 148

  Fly   132 CLLCAEDVVAKGERFSVVTCLYAPCCRNGWFHRRCLQRYANSSG-YFFKCPLCNNTDVFRR-VAY 194
            |.:|. |.:.....:.|:.|   |.|...||||:|:|.||:|:. :||||.||||.:.|:: :..
Zfish   149 CSICL-DPIEPILSYHVLKC---PACHGSWFHRKCVQNYAHSAAMFFFKCTLCNNKEQFQQEMLR 209

  Fly   195 MGIAVLDQDASWETEPDAFAGQYRRDVNCTAALCVAVSGRADTSAM----LLYCTSCGANPSHYL 255
            |||.:.::|||||.|.:||....:....|.|..|:...||..:|..    ::.|..||:..:|..
Zfish   210 MGIYIPERDASWELEENAFVELLQVYHRCDAVKCLCHKGREHSSQSGYFEIVLCKLCGSRGTHRK 274

  Fly   256 CT-LKTLQ-NYVCKVCSAVSPEAVPVAESDSDDAGSMDDSAEAPRPGHLNGD----QIQEKLSPS 314
            |: ::..: :::|..|...:                 :.....|.|.|:...    |.:::|   
Zfish   275 CSNIRVYEADWMCADCKTAA-----------------EGKTSLPLPNHVESPLAIRQERKRL--- 319

  Fly   315 HWDDFGSSDDDAVFQRAFDTKVQSRVVTLSDDQPSTSAGARALADRGTRTFESQGTQ 371
                |.|..|           :.|.:|......|:||  ...|.|...:..:.|.|:
Zfish   320 ----FKSISD-----------IHSSIVAKRQCVPATS--PEVLMDLACQISQQQFTE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 41/112 (37%)
g2e3NP_001003822.1 ePHD_PHF7_G2E3_like 20..133 CDD:277139 41/112 (37%)
PHD_PHF7_G2E3_like 237..290 CDD:276971 12/52 (23%)
HECTc 433..695 CDD:294058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110264at33208
OrthoFinder 1 1.000 - - FOG0003998
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106451
Panther 1 1.100 - - LDO PTHR12420
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10820
SonicParanoid 1 1.000 - - X3283
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.