DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and Phf11

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001019443.1 Gene:Phf11 / 361051 RGDID:1310853 Length:336 Species:Rattus norvegicus


Alignment Length:117 Identity:37/117 - (31%)
Similarity:57/117 - (48%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFGTVHVEGNMMVHRNCLYLSSNLIQRG--EKKLSIMNFLKEDIEAEVNRCRL 67
            |.||..|....:|:  .....|:..|.|||..||.|::.|  :.:....:|..:.::.|:.|.|.
  Rat    28 CALCPDGHEWSVIY--FAPSANIAAHENCLLYSSGLVECGPHDPRNPARSFAVKSVKKEIWRGRR 90

  Fly    68 LKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQNQFCD---TYNSFCHQH 116
            |||..|.:.||.:.|..|.||:::|..|...:.|..|..:   ||..||.:|
  Rat    91 LKCSLCNKGGATVGCDLSSCRKSYHYVCAKKDHAIPQVDEDLGTYKIFCPEH 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 36/115 (31%)
Phf11NP_001019443.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHD_SF 28..142 CDD:304600 36/115 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..179 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..336
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.