DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and Phf11

DIOPT Version :10

Sequence 1:NP_608374.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001019443.1 Gene:Phf11 / 361051 RGDID:1310853 Length:336 Species:Rattus norvegicus


Alignment Length:117 Identity:37/117 - (31%)
Similarity:57/117 - (48%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFGTVHVEGNMMVHRNCLYLSSNLIQRG--EKKLSIMNFLKEDIEAEVNRCRL 67
            |.||..|....:|:  .....|:..|.|||..||.|::.|  :.:....:|..:.::.|:.|.|.
  Rat    28 CALCPDGHEWSVIY--FAPSANIAAHENCLLYSSGLVECGPHDPRNPARSFAVKSVKKEIWRGRR 90

  Fly    68 LKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQNQFCD---TYNSFCHQH 116
            |||..|.:.||.:.|..|.||:::|..|...:.|..|..:   ||..||.:|
  Rat    91 LKCSLCNKGGATVGCDLSSCRKSYHYVCAKKDHAIPQVDEDLGTYKIFCPEH 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_608374.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 36/115 (31%)
RING_Ubox 129..183 CDD:473075
Phf11NP_001019443.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHD_SF 28..142 CDD:473978 36/115 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..179 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..336
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.