DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and G2e3

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001161435.1 Gene:G2e3 / 217558 MGIID:2444298 Length:739 Species:Mus musculus


Alignment Length:322 Identity:107/322 - (33%)
Similarity:163/322 - (50%) Gaps:39/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFG--TVHVEGNMMVHRNCLYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCRL 67
            ||.|...:.....:|  ..:.:.|..||..||.:||.:.|||:::..:..||.|||..||.|...
Mouse    14 CVFCRKNDDCPNKYGEKKTYEKWNFSVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVQRASK 78

  Fly    68 LKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQNQFCDTYNSFCHQHVLVPRNRPV------- 125
            |||..|::.||:|.|....|:|::|..||:......||.|.:.|||.:|      |||       
Mouse    79 LKCTVCKKNGASIGCVVPTCKRSYHLPCGLQKECIFQFTDNFASFCWKH------RPVQAITSNK 137

  Fly   126 FKNDEECLLCAEDVVAKGERFSVVTCLYAPCCRNGWFHRRCLQRYANSSG-YFFKCPLCNNTDVF 189
            :.:...|.:|.|.|    |.......|.:|||:|.||||.|||..|.::| :||:|.||||||:|
Mouse   138 YSSSLPCTICLEFV----EPIPTYNILQSPCCKNAWFHRDCLQVQAINAGVFFFRCTLCNNTDIF 198

  Fly   190 RR-VAYMGIAVLDQDASWETEPDAFAGQYRRDVNCTAALCVAVSGR----ADTSAMLLYCTSCGA 249
            :: :..|||.:.::|||||.|.:|:....:....|....|....||    .::...:..|.|||:
Mouse   199 QKEMLRMGIHIPEKDASWELEENAYQELLQSHDRCDIRRCHCKKGRDYNEPNSKWEVKRCQSCGS 263

  Fly   250 NPSHYLC-TLKTL-QNYVCKVCSAV--------SPEAVPVAESDS---DDAGSMDDSAEAPR 298
            :.:|..| :|::. ||:.|..|..:        :|:. |:|.|.:   .|....:.|::.||
Mouse   264 SGTHLACSSLQSWEQNWECLDCRRITYTSDFQKAPKH-PLANSTNVTVTDCLLEESSSKLPR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 41/112 (37%)
G2e3NP_001161435.1 ePHD_PHF7_G2E3_like 14..127 CDD:277139 41/112 (37%)
PHD_PHF7_G2E3_like 232..285 CDD:276971 14/52 (27%)
HECTc 388..704 CDD:294058
HECTc 411..713 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003998
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106451
Panther 1 1.100 - - LDO PTHR12420
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10820
SonicParanoid 1 1.000 - - X3283
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.