DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and Y75B8A.6

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001368600.1 Gene:Y75B8A.6 / 176645 WormBaseID:WBGene00013543 Length:447 Species:Caenorhabditis elegans


Alignment Length:104 Identity:22/104 - (21%)
Similarity:35/104 - (33%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFGTVHVEGNMMVHRNCLYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCRLLK 69
            |..|    :|...||...|:....:.|.||.:..|.:||...............:..:..|::..
 Worm   101 CTYC----QDSPQFGGPGVKKQSCIERRCLRVLENRLQRDAPTFKARVGCNACEDCRMQDCQICL 161

  Fly    70 CCYCRRLGAN-----IWCCKSGCRRTFHTKCGVDNLAQN 103
            .|..:|...|     ..|.|..|......:|....::||
 Worm   162 VCLDKRFFENRHIPGAMCAKKRCNNAQSIECVPSLMSQN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 22/104 (21%)
Y75B8A.6NP_001368600.1 zf-CXXC 84..125 CDD:366873 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.