DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and Zfp957

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001028387.1 Gene:Zfp957 / 105590 MGIID:2145729 Length:567 Species:Mus musculus


Alignment Length:90 Identity:22/90 - (24%)
Similarity:41/90 - (45%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VHRNC-LYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCRLLKCCYCRRLGANIWCCKSGCRRTFH 92
            ||.:| |:.:...:..|.     :..|.|.:|    ..|.:.|.:|::.||.:.|...||...:|
Mouse   475 VHEDCILWANGTYLVYGR-----LYGLLEALE----NARDVTCSHCQKAGATLGCYNKGCTFRYH 530

  Fly    93 TKCGVD-NLAQNQFCDTYNSFCHQH 116
            ..|.:| :...|:  :.::..|.:|
Mouse   531 YPCAIDADCLLNE--ENFSVRCPKH 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 21/88 (24%)
Zfp957NP_001028387.1 PHD_SF 160..>180 CDD:304600
PHD_SF 469..553 CDD:304600 21/88 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.