DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and Setdb2

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038949803.1 Gene:Setdb2 / 100361710 RGDID:2319564 Length:1008 Species:Rattus norvegicus


Alignment Length:234 Identity:53/234 - (22%)
Similarity:89/234 - (38%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFGTVHVEGNMMVHRNCLYLSSNLIQ-RGEKKLSI-MNFLKEDIEAEVNRCRL 67
            ||||..|....:|:  .....|:..|.|||..||.|:: ......:| .||....:..::.....
  Rat   700 CVLCPEGHDWSVIY--FSPSANIAAHENCLLYSSGLVECEAHDPFNIAKNFDVSSVLEKIWNGST 762

  Fly    68 LKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLA--QNQFCDTYNSFCHQH-------------V 117
            .||.:|...||.:.|.::.|.:.:|..|..::.|  |.....||..||.:|             :
  Rat   763 SKCSFCNNEGAIMGCDETSCAKNYHLLCAKEDRAILQVGVKRTYKIFCPEHPPQQEETTERANGL 827

  Fly   118 LVPRNR----------PVFKNDEECLLCAEDVV--AKGERFSVVTCLYAPCCRNGWFHRRCLQRY 170
            .:.:.|          |......:|......|.  |.|:|.:.|.   ||      |.::||:  
  Rat   828 SIKKRRGRKKRRSLGPPAQPKTMKCRRSRRHVTGEALGQRDAAVK---AP------FLKKCLE-- 881

  Fly   171 ANSSGYFFKCPLCNNTDVFRRVAYMGIAV----LDQDAS 205
               :|..        |::|.::....|::    :|:.||
  Rat   882 ---AGLL--------TELFEQIQQKMISIHGRFMDETAS 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 32/114 (28%)
Setdb2XP_038949803.1 HMT_MBD 152..212 CDD:238689
SET 210..687 CDD:394802
SET 365..>425 CDD:395687
PHD_SF 700..813 CDD:419867 32/114 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.