DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf7 and Phf6

DIOPT Version :9

Sequence 1:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_008771882.1 Gene:Phf6 / 100359714 RGDID:2323526 Length:364 Species:Rattus norvegicus


Alignment Length:419 Identity:80/419 - (19%)
Similarity:115/419 - (27%) Gaps:184/419 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVLCLSGERDELIFGTVHVEGNMMV--HRNCLYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCRL 67
            |..|.|....|.  |.:.:..|..|  |..|:..||.|:.......|:..|..||::.|:.|...
  Rat    17 CGFCKSNRDKEC--GQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTK 79

  Fly    68 LKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQ----------------------NQFCDTYN 110
            |.|..|...||.|.|....|.||:|..|.:.:.||                      |...|...
  Rat    80 LMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEE 144

  Fly   111 SFCHQHVLVP----------RNRPVFKN----------------DE------------------- 130
            || ::|.|.|          :.||...|                ||                   
  Rat   145 SF-NEHELEPSSPKTKKKSRKGRPRKTNLKGLAEDTRSTSSHGTDETESSSYRDRSPHRSSPNDT 208

  Fly   131 --ECLLC---AEDVVAKGERFSVVTCLYAPCCRNGWFHRRCL-------QRYANSSGYF------ 177
              :|..|   .|:..|:|:       |:....:....|.:|:       |....|...|      
  Rat   209 RPKCGFCHVGEEENEARGK-------LHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIK 266

  Fly   178 -----------FKCPLCNNTDVFRRVAYMGIAVLDQDASWETEPDAFAGQYRRDVNCTAALCVAV 231
                       .||.||                        ::|.|..|       |....||  
  Rat   267 TVLQEIKRGKRMKCTLC------------------------SQPGATIG-------CEIKACV-- 298

  Fly   232 SGRADTSAMLLYCTSCGANPSHYLCTLKTLQNYV-----------CKVCSAVSPEAVPVAESDSD 285
                              ...||.|.::....|:           ||            ..|.:|
  Rat   299 ------------------KTYHYHCGVQDKAKYIENMSRGIYKLYCK------------NHSGND 333

  Fly   286 DAGSMDDSAEAPRPGHLNGDQ--IQEKLS 312
            :....|:..|:...|.:..||  .|::|:
  Rat   334 ERDEEDEERESKSRGRVAIDQQLTQQQLN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 36/134 (27%)
Phf6XP_008771882.1 ePHD1_PHF6 17..131 CDD:277180 32/115 (28%)
ePHD2_PHF6 212..329 CDD:277181 27/186 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.