DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and TEM1

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_013647.1 Gene:TEM1 / 854938 SGDID:S000004529 Length:245 Species:Saccharomyces cerevisiae


Alignment Length:154 Identity:42/154 - (27%)
Similarity:80/154 - (51%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRTITSTY 77
            ::||:.|||:||::::..:.:...|..|:||:|..|.|.|....:...|.|..||..|..:....
Yeast    25 LVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIA 89

  Fly    78 YRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKND-----DPDRKVVITEDAQR 137
            ..|:..:|.::|:|..|:.::::.|..:.....|....:|||.|.|     ||:.:..|:..:.:
Yeast    90 TVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMK 154

  Fly   138 FAKQMDIELFETSAKDNINVENMF 161
            :|:.|:..|...|...:||::.:|
Yeast   155 YAQVMNAPLIFCSTAKSINIQKIF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 42/154 (27%)
TEM1NP_013647.1 Spg1 21..202 CDD:206701 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.