DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and SEC4

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:87/202 - (43%)
Similarity:133/202 - (65%) Gaps:5/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQ 67
            :.:|.:.|:|:|||||||||.||:||.:|.|:.|:|||||:||||:||||.|.:||||:||||||
Yeast    15 KSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQ 79

  Fly    68 ERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC-DVVKKVLVGNKNDDPDRKVVI 131
            |||||||:.||||..|:|:|||||:..:|.|:::|.:.:..:. |..:.:|||||: |.:.:||.
Yeast    80 ERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKS-DMETRVVT 143

  Fly   132 TEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQV---LDHKLRTSPNEQQKDTLHLKPNPKG 193
            .:..:..||::.|...|:|||::.||..:|.::.:.:   :|..........::..:.:......
Yeast   144 ADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVGNGKEGNISINSGSGN 208

  Fly   194 SKGGKCC 200
            |....||
Yeast   209 SSKSNCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 87/202 (43%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 83/165 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.