DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and RAB8C

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_195972.1 Gene:RAB8C / 831817 AraportID:AT5G03520 Length:216 Species:Arabidopsis thaliana


Alignment Length:212 Identity:111/212 - (52%)
Similarity:142/212 - (66%) Gaps:26/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :|:|.|||:|||||||||.||:|||||||:.|:|||||:|||||||:::|.|:||||||||||||
plant    12 YDYLIKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIKLQIWDTAGQER 76

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEI-QNNCDVVKKVLVGNKND-DPDRKVVIT 132
            |||||:.||||..|:::|||||:..||.|:|.|::.| |:..|.|.|:|||||.| |..::.|.|
plant    77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDNVNKILVGNKADMDESKRAVPT 141

  Fly   133 EDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSKGG 197
            ...|..|.:..|:.||||||.|:||||:|:||.:.:......|       ||   |..|:|.|..
plant   142 AKGQALADEYGIKFFETSAKTNLNVENVFMSIAKDIKQRLTET-------DT---KAEPQGIKIT 196

  Fly   198 K--------------CC 200
            |              ||
plant   197 KQDTAASSSTAEKSACC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 111/212 (52%)
RAB8CNP_195972.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 101/166 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.