DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab35

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_937806.1 Gene:Rab35 / 77407 MGIID:1924657 Length:201 Species:Mus musculus


Alignment Length:203 Identity:146/203 - (71%)
Similarity:164/203 - (80%) Gaps:5/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTA 65
            |||.:||||||||||||||||||||:||:|:|||||||||||||||||||:|.|.:|||||||||
Mouse     1 MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTA 65

  Fly    66 GQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKVV 130
            ||||||||||||||||||||||||||:.|||.||:|||.||..|||.|.::|||||||||:||||
Mouse    66 GQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVV 130

  Fly   131 ITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHK---LRTSPNEQQKDTLHLKPNPK 192
            .||||.:||.||.|:|||||||:|:|||.||..||..||..|   |.....:||.|.:.|..|.|
Mouse   131 ETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSK 195

  Fly   193 GSKGGKCC 200
            ..|  :||
Mouse   196 RKK--RCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 144/201 (72%)
Rab35NP_937806.1 Rab35 3..201 CDD:133310 144/201 (72%)
Effector region. /evidence=ECO:0000250 37..45 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 257 1.000 Domainoid score I2011
eggNOG 1 0.900 - - E1_KOG0079
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H21361
Inparanoid 1 1.050 285 1.000 Inparanoid score I2832
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005049
OrthoInspector 1 1.000 - - oto92546
orthoMCL 1 0.900 - - OOG6_107949
Panther 1 1.100 - - LDO PTHR47977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4372
SonicParanoid 1 1.000 - - X3575
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.