DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab43

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001038812.1 Gene:rab43 / 751627 ZFINID:ZDB-GENE-060825-25 Length:208 Species:Danio rerio


Alignment Length:201 Identity:83/201 - (41%)
Similarity:122/201 - (60%) Gaps:10/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :|.:||::::||.||||:.::.||....|......||||||.::|::|.|.||||||||||||||
Zfish    10 YDLVFKIVLVGDVGVGKTCVVQRFKTGIFIEKQGNTIGVDFTMKTLEIHGKRVKLQIWDTAGQER 74

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQ--NNCDVVKKVLVGNKNDDPDRKVVIT 132
            |||||.:|||..:|.|:.||:|...:|.:|.:|:|:::  ...::| .:|:|||.|..:.:.|..
Zfish    75 FRTITQSYYRSANGAIITYDITKKATFLSVPKWMEDVKKYGGSNIV-PLLIGNKCDLSESREVPL 138

  Fly   133 EDAQRFAKQMD-IELFETSAKDNINVENMFLSITRQ-VLDHKLRTSP--NEQQKDTLHLKPNPKG 193
            ||||..|.|:| :...||||||:.||:..|..:..: :|.|   ..|  .|...|:..|......
Zfish   139 EDAQTMAHQLDFVSAIETSAKDSSNVDEAFNKMASELILRH---GGPMFTENVTDSFKLTGKDVA 200

  Fly   194 SKGGKC 199
            .:|..|
Zfish   201 GEGWGC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 83/201 (41%)
rab43NP_001038812.1 P-loop_NTPase 11..175 CDD:304359 75/164 (46%)
RAB 14..178 CDD:197555 74/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.