Sequence 1: | NP_001188678.1 | Gene: | Rab35 / 33014 | FlyBaseID: | FBgn0031090 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004152.1 | Gene: | RAB1A / 5861 | HGNCID: | 9758 | Length: | 205 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 109/201 - (54%) |
---|---|---|---|
Similarity: | 143/201 - (71%) | Gaps: | 8/201 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
Fly 70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC-DVVKKVLVGNKNDDPDRKVVITE 133
Fly 134 DAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNE----QQKDTLHLKPNPKGS 194
Fly 195 KGGKCC 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab35 | NP_001188678.1 | Rab35 | 3..201 | CDD:133310 | 109/201 (54%) |
RAB1A | NP_004152.1 | Rab1_Ypt1 | 10..175 | CDD:206661 | 100/167 (60%) |
Effector region. /evidence=ECO:0000255 | 40..48 | 6/7 (86%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 178..205 | 5/26 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1149105at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |