DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab12

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001018466.1 Gene:rab12 / 553657 ZFINID:ZDB-GENE-050522-555 Length:235 Species:Danio rerio


Alignment Length:193 Identity:82/193 - (42%)
Similarity:125/193 - (64%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQ 67
            |..|:..:::|||..||||:||:.||:||||..:..:|:||||||:||::.|.:::|||||||||
Zfish    30 RAADYKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQ 94

  Fly    68 ERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC-DVVKKVLVGNKNDDPDRKVVI 131
            |||.:|||.||||..|:::|||:|..|:|.::.:|::.|.... :..:.:|||||.|....:.:.
Zfish    95 ERFNSITSAYYRGAKGIVLVYDITKQETFEDLPKWMKMIDKYASEDAELLLVGNKLDCESDRAIS 159

  Fly   132 TEDAQRFAKQMD-IELFETSAKDNINVENMFLSITRQVLDH-KLRTSPNEQQKDTLHLKPNPK 192
            .:.|:|||.::. :...|.|||||.||:.:||.:...:|.. .|.....|.....|.|:|.|:
Zfish   160 RQQAERFASRISGMRFCEASAKDNFNVDEIFLKLVDDILSKMPLEVPSKELSNSVLSLQPEPE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 82/193 (42%)
rab12NP_001018466.1 Rab12 36..235 CDD:206699 80/187 (43%)
RAB 36..200 CDD:197555 74/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.