DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab19

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001017246.1 Gene:rab19 / 550000 XenbaseID:XB-GENE-495128 Length:213 Species:Xenopus tropicalis


Alignment Length:201 Identity:78/201 - (38%)
Similarity:123/201 - (61%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            ||.|||:::||||.|||:.::.||....|:.:...||||||.:|.::|.|.:||:|:||||||||
 Frog    12 FDFLFKIILIGDSNVGKTCVVHRFQSGVFAHNQQNTIGVDFTVRNMNINGKKVKVQVWDTAGQER 76

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN-NCDVVKKVLVGNKNDDPDRKVVITE 133
            |||||.:|||..||.|:.||:|..:||.:|..|:.|.:. ....:..:|:|||:|..:::.::.|
 Frog    77 FRTITQSYYRSAHGAIIAYDITRRQSFESVPHWIYEAEKYGAANLMMMLIGNKSDLAEKRQILFE 141

  Fly   134 DAQRFAKQMD-IELFETSAKDNINVENMFLSITRQ------------------VLDHKLRTSPNE 179
            :|...|::.. :.:.|||||::.||:.:||.:.::                  :||.|...:|.|
 Frog   142 EACTLAEKHGLLAVLETSAKESHNVDEVFLLMAKELIARNTFHYHSESPRNSFMLDSKPVLAPPE 206

  Fly   180 QQKDTL 185
            ..|:.|
 Frog   207 PDKNCL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 78/201 (39%)
rab19NP_001017246.1 Rab19 13..177 CDD:133267 70/163 (43%)
Effector region. /evidence=ECO:0000250 44..52 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.