Sequence 1: | NP_001188678.1 | Gene: | Rab35 / 33014 | FlyBaseID: | FBgn0031090 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057614.1 | Gene: | RAB8B / 51762 | HGNCID: | 30273 | Length: | 207 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 92/197 - (46%) |
---|---|---|---|
Similarity: | 138/197 - (70%) | Gaps: | 11/197 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTA 65
Fly 66 GQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDV-VKKVLVGNKNDDPDRKV 129
Fly 130 VITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGS 194
Fly 195 KG 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab35 | NP_001188678.1 | Rab35 | 3..201 | CDD:133310 | 90/195 (46%) |
RAB8B | NP_057614.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 84/170 (49%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 4/7 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |