DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab43

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001019502.1 Gene:Rab43 / 500249 RGDID:1565300 Length:210 Species:Rattus norvegicus


Alignment Length:192 Identity:83/192 - (43%)
Similarity:126/192 - (65%) Gaps:8/192 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :|.||||:::||:.|||:.::.||....||....:||||||.::|::|:|.||||||||||||||
  Rat    13 YDFLFKLVLVGDASVGKTCVVQRFKTGAFSARQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQER 77

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN--NCDVVKKVLVGNKNDDPDRKVVIT 132
            |||||.:|||..:|.|:.||::...:|.:|..|:|:::.  ..::| ::|:|||:|..|.:.|..
  Rat    78 FRTITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGSNIV-QLLIGNKSDLADLREVPL 141

  Fly   133 EDAQRFAKQMDIE-LFETSAKDNINVENMFLSI-TRQVLDHKLRTSPNEQQKDTLHLKPNPK 192
            .:||..|:..||. ..||||||:.|||..|..: |..::.|   ..|...:|:|.|::.:.|
  Rat   142 AEAQSLAEHYDILCAIETSAKDSSNVEEAFTRVATELIMRH---GGPMFSEKNTDHIQLDSK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 83/192 (43%)
Rab43NP_001019502.1 Rab19 14..178 CDD:133267 77/164 (47%)
Effector region. /evidence=ECO:0000250 45..53 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.