DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab19

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001019497.1 Gene:Rab19 / 500088 RGDID:1565263 Length:217 Species:Rattus norvegicus


Alignment Length:187 Identity:73/187 - (39%)
Similarity:122/187 - (65%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERF 70
            |:|||:::||||.|||:.::..|....:|.|...||||||.:|:::|:|.:||:|:|||||||||
  Rat    15 DYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERF 79

  Fly    71 RTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN----NCDVVKKVLVGNKNDDPDRKVVI 131
            ||||.:|||..|..|:.||:|...:|.:|..|:.||:.    |..:   :|:|||:|..:::.|:
  Rat    80 RTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVI---MLIGNKSDLWEKRHVL 141

  Fly   132 TEDAQRFAKQMD-IELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHL 187
            .|||...|::.. :.:.|||||::.|::.:|:.:.::::           .:::|||
  Rat   142 FEDACTLAEKYGLLAVLETSAKESRNIDEVFVLMAKELI-----------ARNSLHL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 73/187 (39%)
Rab19NP_001019497.1 Rab19 15..179 CDD:133267 70/166 (42%)
Effector region. /evidence=ECO:0000250 46..54 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.