DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab30

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001006108.1 Gene:rab30 / 448082 XenbaseID:XB-GENE-479337 Length:203 Species:Xenopus tropicalis


Alignment Length:167 Identity:79/167 - (47%)
Similarity:116/167 - (69%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :|.|||:::||::||||:.|:.||:...|......||||||.|:||:|:|.::||||||||||||
 Frog     6 YDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEIKGEKIKLQIWDTAGQER 70

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN--NCDVVKKVLVGNKNDDPDRKVVIT 132
            ||:||.:|||..:.:|:.||:|..|||..:..||.||:.  |.:|: .||||||.|..:|:.|..
 Frog    71 FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYANSEVI-TVLVGNKIDLAERREVSQ 134

  Fly   133 EDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVL 169
            :.|:.||...::...|||||::.|||.:||.:..:::
 Frog   135 QRAEEFAGTQNMYYLETSAKESDNVEKLFLDLACRLI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 79/167 (47%)
rab30NP_001006108.1 Rab30 3..171 CDD:133314 79/165 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.