DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab35

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_989019.1 Gene:rab35 / 394615 XenbaseID:XB-GENE-489018 Length:201 Species:Xenopus tropicalis


Alignment Length:203 Identity:147/203 - (72%)
Similarity:165/203 - (81%) Gaps:5/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTA 65
            |||.:||||||||||||||||||||:||:|:|||||||||||||||||||:|.|.:|||||||||
 Frog     1 MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTA 65

  Fly    66 GQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKVV 130
            ||||||||||||||||||||||||||:.|||.||:|||.||..|||.|.::|||||||||:||||
 Frog    66 GQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVV 130

  Fly   131 ITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHK---LRTSPNEQQKDTLHLKPNPK 192
            .||||.:||.||||:|||||||:|:|||.||..||..||..|   |.....:||.|.:.|..|.|
 Frog   131 ETEDAYKFAAQMDIQLFETSAKENLNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLSKNSK 195

  Fly   193 GSKGGKCC 200
            ..|  :||
 Frog   196 RKK--RCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 145/201 (72%)
rab35NP_989019.1 Rab35 3..201 CDD:133310 143/199 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H21361
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0005049
OrthoInspector 1 1.000 - - otm47869
Panther 1 1.100 - - LDO PTHR47977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4372
SonicParanoid 1 1.000 - - X3575
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.