DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab35l

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_989002.1 Gene:rab35l / 394598 XenbaseID:XB-GENE-5809894 Length:201 Species:Xenopus tropicalis


Alignment Length:208 Identity:137/208 - (65%)
Similarity:161/208 - (77%) Gaps:18/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAG 66
            |:.:|||||||:||||||||||||:||||::|||||||||||||||||:.::|.|||||||||||
 Frog     3 AKDYDHLFKLLLIGDSGVGKSSLLLRFSDNSFSGSYITTIGVDFKIRTLVLDGERVKLQIWDTAG 67

  Fly    67 QERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKVVI 131
            |||||||||||||.|||||||||||:.|||.||:|||.||..|||.|..||||||:|||.||.|.
 Frog    68 QERFRTITSTYYRNTHGVIVVYDVTSPESFVNVKRWLHEITQNCDSVCTVLVGNKDDDPSRKRVE 132

  Fly   132 TEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVL----DHKLRTSPNE-----QQKDTLHL 187
            ..||:|||.||.:.:||||||:|.|||.||||:||.||    |::.|.:|:|     :.|...|:
 Frog   133 AADAKRFADQMGVRMFETSAKENRNVEEMFLSVTRMVLRMKKDNQARLNPSEVVTITKTKKKPHV 197

  Fly   188 KPNPKGSKGGKCC 200
            |         :||
 Frog   198 K---------RCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 136/207 (66%)
rab35lNP_989002.1 P-loop_NTPase 4..201 CDD:393306 134/205 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2118
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I2997
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0005049
OrthoInspector 1 1.000 - - otm47869
Panther 1 1.100 - - O PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3575
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.