DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and RabX5

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:214 Identity:67/214 - (31%)
Similarity:101/214 - (47%) Gaps:25/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRTIT 74
            |::.:||..|||::::.||..|.|..:|..||||||::....|.|....|::||||||||||.|.
  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130

  Fly    75 STYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKK---VLVGNKND--DPDRKVVITED 134
            ..|||....::|.||::..:|..:.::||.... |.:..|:   .|||.|.|  ..:..|.:...
  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSAL-NYNASKRPLVFLVGTKADLLSKEEFVRMERL 194

  Fly   135 AQRFAKQMDIELFETSAKDNINVENMFLSITRQVLD-------HKLRTSPNEQ------QKDTLH 186
            |...|.::..|.:..||:....|..:|..|.....:       ..::..|.||      :..|..
  Fly   195 AGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASVKSQTFD 259

  Fly   187 LKPNPKGS-----KGGKCC 200
            |: |..||     |.|..|
  Fly   260 LR-NFFGSRLSQQKSGCTC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 67/214 (31%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 56/164 (34%)
RAB 66..225 CDD:197555 55/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.