DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab13

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_958486.1 Gene:rab13 / 373105 ZFINID:ZDB-GENE-030826-30 Length:200 Species:Danio rerio


Alignment Length:194 Identity:94/194 - (48%)
Similarity:139/194 - (71%) Gaps:14/194 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTA 65
            ||:.:|.|||||:||||||||:.|:|||::|.|:.:||:|||:|||::|:::||.:||||:||||
Zfish     1 MAKKYDFLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTA 65

  Fly    66 GQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDV-VKKVLVGNKNDDPDRKV 129
            |||||:|||:.||||..|:|:|||:|:.:|:.|::.|::.|:.|... |.::|:|||.|...::.
Zfish    66 GQERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAGVSRMLLGNKCDIEAKRK 130

  Fly   130 VITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKG 193
            |..|..::.||:..|..||||||.:||||..|.|:.|.:|   |:::.          ||.|.|
Zfish   131 VSKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDIL---LKSNK----------KPGPSG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 92/192 (48%)
rab13NP_958486.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 87/168 (52%)
RAB 9..170 CDD:197555 84/160 (53%)
Effector region. /evidence=ECO:0000250 37..45 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.