DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab4

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster


Alignment Length:205 Identity:84/205 - (40%)
Similarity:115/205 - (56%) Gaps:14/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTA 65
            |:..:|:|||.||||.:|.|||.||..|.:..|......||||:|..|.|::.|..|||||||||
  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65

  Fly    66 GQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDV-VKKVLVGNKNDDPDRKV 129
            ||||||::|.:||||..|.::|||.|:.:||..:..||.:.:..... :..:|||||.|..:.:.
  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARD 130

  Fly   130 VITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGS 194
            |...:|..||::.::...|||||...|||..||..::.:| .|:.|.         .|.|...||
  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTIL-AKIETG---------ELDPERIGS 185

  Fly   195 ---KGGKCCR 201
               .||...|
  Fly   186 GIQYGGAALR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 82/201 (41%)
Rab4NP_523777.1 Rab4 9..169 CDD:206696 71/159 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.