DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab3

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:206 Identity:91/206 - (44%)
Similarity:138/206 - (66%) Gaps:12/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQ 67
            :.||::|||||||:|.|||:|.|.|::||:|:.::::|:|:|||::||.....||||||||||||
  Fly    16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQ 80

  Fly    68 ERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN-NCDVVKKVLVGNKNDDPDRKVVI 131
            ||:||||:.||||..|.|::|||||.:||.:|:.|:.:|:. :.|..:.:|||||.|..|::|:.
  Fly    81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145

  Fly   132 TEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTL--------HLK 188
            .|..::.|.|:.:|.||||||:|:||:.:|..:...:.|   :.|.:.....||        .|.
  Fly   146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICD---KMSESLDADPTLVGGGQKGQRLT 207

  Fly   189 PNPKGSKGGKC 199
            ..|:|:....|
  Fly   208 DQPQGTPNANC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 91/206 (44%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 82/166 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.