DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab32

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:210 Identity:68/210 - (32%)
Similarity:115/210 - (54%) Gaps:22/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMR-VKLQIWDTAGQER 69
            :||:|:|:||:.|.||:|.:.|:....||.:|..||||||.::.:..:... |:||:||.|||||
  Fly   481 EHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQER 545

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDV-----VKKVLVGNKNDDPDRKV 129
            |..:|..||:...|..:|:|||...:|..|.:|.|::.:...:     :..:|:.||.|. :::.
  Fly   546 FGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQ-EKQG 609

  Fly   130 VITEDAQRFAKQMDIEL--------FETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLH 186
            :||:     .::||..:        ||||||:|||::....::..::|.:....|.:....|..:
  Fly   610 IITQ-----PEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADGDKFN 669

  Fly   187 LK-PNPKGSKG-GKC 199
            |. .:..||.. .||
  Fly   670 LSAADATGSDAKNKC 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 68/210 (32%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 66/207 (32%)
RAB 484..652 CDD:197555 58/173 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.