DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab14

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:190 Identity:71/190 - (37%)
Similarity:112/190 - (58%) Gaps:3/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            ::::||.:||||.|||||.||.:|::..|..:...||||:|..|.::::..::||||||||||||
  Fly    32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQER 96

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKV-LVGNKNDDPDRKVVITE 133
            ||.:|.:||||..|.::|||:|...::.::..||.:.:|..:....: |:|||:|....:.|..|
  Fly    97 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYE 161

  Fly   134 DAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDH--KLRTSPNEQQKDTLHLKPNP 191
            :|:.||.:..:...|.||....|||..||...|::..:  :.|...|..:....|....|
  Fly   162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 71/190 (37%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 67/164 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.